PROC Antikörper

Produktnummer ABIN630170

Produktdetails anti-PROC Antikörper

Target: PROC (Vitamin K-dependent protein C (PROC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PROC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Protein C Blocking Peptide, catalog no. 33R-6620, is also available for use as a blocking control in assays to test for specificity of this Protein C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PROC

Target: PROC (Vitamin K-dependent protein C (PROC))

Andere Bezeichnung: Protein C (PROC Produkte)

Synonyme: proc antikoerper, si:ch1073-188c16.3 antikoerper, zgc:63987 antikoerper, PROC antikoerper, APC antikoerper, PC antikoerper, PROC1 antikoerper, THPH3 antikoerper, THPH4 antikoerper, proc1 antikoerper, MGC64425 antikoerper, PA antikoerper, protein C, inactivator of coagulation factors Va and VIIIa antikoerper, protein C (inactivator of coagulation factors Va and VIIIa), a antikoerper, protein C (inactivator of coagulation factors Va and VIIIa) antikoerper, protein C, inactivator of coagulation factors Va and VIIIa S homeolog antikoerper, vitamin K-dependent protein C antikoerper, prosaposin antikoerper, protein C antikoerper, proline rich protein HaeIII subfamily 1 antikoerper, PROC antikoerper, proca antikoerper, proc.S antikoerper, proc antikoerper, CpipJ_CPIJ000393 antikoerper, CpipJ_CPIJ002754 antikoerper, CpipJ_CPIJ003717 antikoerper, CpipJ_CPIJ003718 antikoerper, CpipJ_CPIJ014440 antikoerper, CpipJ_CPIJ018032 antikoerper, CpipJ_CPIJ018737 antikoerper, PSAP antikoerper, Proc antikoerper, PRH1 antikoerper

Substanzklasse: Viral Protein

Hintergrund: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

Molekulargewicht: 52 kDa (MW of target protein)