P2RX1 Antikörper (Middle Region)

Produktnummer ABIN630119

Produktdetails anti-P2RX1 Antikörper

Target: P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P2RX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: P2 RX1 antibody was raised against the middle region of P2 X1

Aufreinigung: Purified

Immunogen: P2 RX1 antibody was raised using the middle region of P2 X1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P2RX1 Blocking Peptide, catalog no. 33R-9880, is also available for use as a blocking control in assays to test for specificity of this P2RX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P2RX1

Target: P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))

Andere Bezeichnung: P2RX1 (P2RX1 Produkte)

Synonyme: p2xr1 antikoerper, P2X1 antikoerper, AI323649 antikoerper, BB122383 antikoerper, P2x antikoerper, Pdcd3 antikoerper, RP-2 antikoerper, P2XMR antikoerper, P2X1R antikoerper, purinergic receptor P2X, ligand-gated ion channel, 1 antikoerper, purinergic receptor P2X 1 antikoerper, calcium/calmodulin dependent protein kinase kinase 1 antikoerper, p2rx1 antikoerper, P2RX1 antikoerper, P2rx1 antikoerper, CAMKK1 antikoerper

Hintergrund: P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity