VDAC1 Antikörper (C-Term)

Produktnummer ABIN630114

Produktdetails anti-VDAC1 Antikörper

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VDAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: VDAC1 antibody was raised against the C terminal of VDAC1

Aufreinigung: Purified

Immunogen: VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDAC1 Blocking Peptide, catalog no. 33R-8303, is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VDAC1

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Andere Bezeichnung: VDAC1 (VDAC1 Produkte)

Synonyme: vdac1 antikoerper, VDAC1 antikoerper, 5076 antikoerper, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1 antikoerper, ATVDAC1 antikoerper, T22N4.9 antikoerper, T22N4_9 antikoerper, voltage dependent anion channel 1 antikoerper, PORIN antikoerper, VDAC-1 antikoerper, AL033343 antikoerper, Vdac5 antikoerper, fa13f11 antikoerper, wu:fa13f11 antikoerper, zgc:85830 antikoerper, voltage-dependent anion channel 1 S homeolog antikoerper, voltage-dependent anion channel 1 antikoerper, voltage dependent anion channel 1 antikoerper, vdac1.S antikoerper, vdac1 antikoerper, VDAC1 antikoerper, Vdac1 antikoerper

Hintergrund: The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

Molekulargewicht: 31 kDa (MW of target protein)