KCNQ1 Antikörper (N-Term)

Produktnummer ABIN630110

Produktdetails anti-KCNQ1 Antikörper

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNQ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNQ1 antibody was raised against the N terminal of KCNQ1

Aufreinigung: Purified

Immunogen: KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNQ1 Blocking Peptide, catalog no. 33R-4211, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNQ1

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Andere Bezeichnung: KCNQ1 (KCNQ1 Produkte)

Synonyme: ATFB1 antikoerper, ATFB3 antikoerper, JLNS1 antikoerper, KCNA8 antikoerper, KCNA9 antikoerper, KVLQT1 antikoerper, Kv1.9 antikoerper, Kv7.1 antikoerper, LQT antikoerper, LQT1 antikoerper, RWS antikoerper, SQT2 antikoerper, WRS antikoerper, CG12215 antikoerper, CG12915 antikoerper, CG33135 antikoerper, DKCNQ antikoerper, Dmel\\CG33135 antikoerper, dKCNQ antikoerper, kcnq1 antikoerper, KCNQ1 antikoerper, kqt-3 antikoerper, kv7.1 antikoerper, Kvlqt1 antikoerper, KvLQT-1 antikoerper, kcnq1-A antikoerper, xkvlqt1 antikoerper, zgc:158384 antikoerper, AW559127 antikoerper, Kcna9 antikoerper, KvLQT1 antikoerper, potassium voltage-gated channel subfamily Q member 1 antikoerper, KCNQ potassium channel antikoerper, potassium voltage-gated channel, KQT-like subfamily, member 1 antikoerper, potassium channel, voltage gated KQT-like subfamily Q, member 1 antikoerper, voltage gated potassium channel subunit antikoerper, potassium channel, voltage gated KQT-like subfamily Q, member 1 L homeolog antikoerper, potassium voltage-gated channel, subfamily Q, member 1 antikoerper, KCNQ1 antikoerper, KCNQ antikoerper, kcnq1 antikoerper, Kcnq1 antikoerper, kcnq1.L antikoerper

Hintergrund: KCNQ1 encodes a protein for a voltage-gated potassium channel required for the repolarization phase of the cardiac action potential. The gene product can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in KCNQ1 are associated with hereditary long QT syndrome, Romano-Ward syndrome, Jervell and Lange-Nielsen syndrome and familial atrial fibrillation.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Sensory Perception of Sound