GRIK2 Antikörper (N-Term)

Produktnummer ABIN630103

Produktdetails anti-GRIK2 Antikörper

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRIK2 antibody was raised against the N terminal of GRIK2

Aufreinigung: Purified

Immunogen: GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIK2 Blocking Peptide, catalog no. 33R-5447, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRIK2

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Andere Bezeichnung: GRIK2 (GRIK2 Produkte)

Synonyme: GRIK5 antikoerper, eaa4 antikoerper, glr6 antikoerper, gluk6 antikoerper, glur6 antikoerper, grik2 antikoerper, mrt6 antikoerper, GluR6 antikoerper, grik2-A antikoerper, EAA4 antikoerper, GLR6 antikoerper, GLUK6 antikoerper, GLUR6 antikoerper, GluK2 antikoerper, MRT6 antikoerper, AW124492 antikoerper, Glur-6 antikoerper, Glur6 antikoerper, Glurbeta2 antikoerper, GRIK2 antikoerper, glutamate ionotropic receptor kainate type subunit 2 antikoerper, glutamate receptor, ionotropic, kainate 2 L homeolog antikoerper, glutamate receptor, ionotropic, kainate 2 antikoerper, glutamate receptor, ionotropic, kainate 2 (beta 2) antikoerper, GRIK2 antikoerper, grik2.L antikoerper, grik2 antikoerper, Grik2 antikoerper

Hintergrund: GRIK2 encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity