KCND3 Antikörper (Middle Region)
-
- Target Alle KCND3 Antikörper anzeigen
- KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCND3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCND3 antibody was raised against the middle region of KCND3
- Aufreinigung
- Purified
- Immunogen
- KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE
- Top Product
- Discover our top product KCND3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCND3 Blocking Peptide, catalog no. 33R-4258, is also available for use as a blocking control in assays to test for specificity of this KCND3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))
- Andere Bezeichnung
- KCND3 (KCND3 Produkte)
- Synonyme
- KCND3 antikoerper, zgc:55306 antikoerper, wu:fi06g01 antikoerper, kv4.3 antikoerper, K(v)4.3 antikoerper, AW045978 antikoerper, Kncd3 antikoerper, Kv4.3 antikoerper, KCND3L antikoerper, KCND3S antikoerper, KSHIVB antikoerper, KV4.3 antikoerper, kcnd3-A antikoerper, xKv4.3 antikoerper, potassium voltage-gated channel subfamily D member 3 antikoerper, potassium voltage-gated channel, Shal-related subfamily, member 3 antikoerper, potassium channel, voltage gated Shal related subfamily D, member 3 antikoerper, potassium voltage-gated channel, Shal-related family, member 3 antikoerper, potassium channel, voltage gated Shal related subfamily D, member 3 L homeolog antikoerper, KCND3 antikoerper, kcnd3 antikoerper, Kcnd3 antikoerper, kcnd3.L antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
- Molekulargewicht
- 70 kDa (MW of target protein)
-