KCND3 Antikörper (Middle Region)

Produktnummer ABIN630099

Produktdetails anti-KCND3 Antikörper

Target: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCND3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCND3 antibody was raised against the middle region of KCND3

Aufreinigung: Purified

Immunogen: KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCND3 Blocking Peptide, catalog no. 33R-4258, is also available for use as a blocking control in assays to test for specificity of this KCND3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCND3

Target: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Andere Bezeichnung: KCND3 (KCND3 Produkte)

Synonyme: KCND3 antikoerper, zgc:55306 antikoerper, wu:fi06g01 antikoerper, kv4.3 antikoerper, K(v)4.3 antikoerper, AW045978 antikoerper, Kncd3 antikoerper, Kv4.3 antikoerper, KCND3L antikoerper, KCND3S antikoerper, KSHIVB antikoerper, KV4.3 antikoerper, kcnd3-A antikoerper, xKv4.3 antikoerper, potassium voltage-gated channel subfamily D member 3 antikoerper, potassium voltage-gated channel, Shal-related subfamily, member 3 antikoerper, potassium channel, voltage gated Shal related subfamily D, member 3 antikoerper, potassium voltage-gated channel, Shal-related family, member 3 antikoerper, potassium channel, voltage gated Shal related subfamily D, member 3 L homeolog antikoerper, KCND3 antikoerper, kcnd3 antikoerper, Kcnd3 antikoerper, kcnd3.L antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Molekulargewicht: 70 kDa (MW of target protein)