OLA1 Antikörper
-
- Target Alle OLA1 Antikörper anzeigen
- OLA1 (Obg-Like ATPase 1 (OLA1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OLA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH
- Top Product
- Discover our top product OLA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GTPBP9 Blocking Peptide, catalog no. 33R-3413, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OLA1 (Obg-Like ATPase 1 (OLA1))
- Andere Bezeichnung
- GTPBP9 (OLA1 Produkte)
- Synonyme
- MGC79585 antikoerper, PTD004 antikoerper, GTPBP9 antikoerper, DOC45 antikoerper, GBP45 antikoerper, GTBP9 antikoerper, 2510025G09Rik antikoerper, 2810405J23Rik antikoerper, 2810409H07Rik antikoerper, Gtpbp9 antikoerper, RGD1307982 antikoerper, fe36h01 antikoerper, wu:fc66b09 antikoerper, wu:fe36h01 antikoerper, wu:fk82a02 antikoerper, zgc:55768 antikoerper, zgc:85691 antikoerper, Obg-like ATPase 1 antikoerper, Obg like ATPase 1 antikoerper, Obg-like ATPase 1 L homeolog antikoerper, ola1 antikoerper, OLA1 antikoerper, Ola1 antikoerper, ola1.L antikoerper
- Hintergrund
- GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
- Molekulargewicht
- 44 kDa (MW of target protein)
-