CPSF6 Antikörper (Middle Region)
-
- Target Alle CPSF6 Antikörper anzeigen
- CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPSF6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CPSF6 antibody was raised against the middle region of CPSF6
- Aufreinigung
- Purified
- Immunogen
- CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
- Top Product
- Discover our top product CPSF6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.3125 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CPSF6 Blocking Peptide, catalog no. 33R-7262, is also available for use as a blocking control in assays to test for specificity of this CPSF6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))
- Andere Bezeichnung
- CPSF6 (CPSF6 Produkte)
- Synonyme
- CPSF6 antikoerper, wu:fa22f12 antikoerper, zgc:85819 antikoerper, 4733401N12Rik antikoerper, AI256641 antikoerper, CFIM antikoerper, CFIM68 antikoerper, HPBRII-4 antikoerper, HPBRII-7 antikoerper, cleavage and polyadenylation specific factor 6 antikoerper, cleavage and polyadenylation specific factor 6 S homeolog antikoerper, CPSF6 antikoerper, cpsf6.S antikoerper, cpsf6 antikoerper, Cpsf6 antikoerper
- Hintergrund
- CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.
- Molekulargewicht
- 61 kDa (MW of target protein)
-