NUDT21 Antikörper

Produktnummer ABIN630019

Produktdetails anti-NUDT21 Antikörper

Target: NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDT21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDT21 Blocking Peptide, catalog no. 33R-9098, is also available for use as a blocking control in assays to test for specificity of this NUDT21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDT21

Target: NUDT21 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (NUDT21))

Andere Bezeichnung: NUDT21 (NUDT21 Produkte)

Synonyme: CFIM25 antikoerper, CPSF5 antikoerper, 25kDa antikoerper, 3110048P04Rik antikoerper, 5730530J16Rik antikoerper, AU014860 antikoerper, AW549947 antikoerper, Cpsf5 antikoerper, zgc:63966 antikoerper, cpsf5 antikoerper, An16g01870 antikoerper, AO090003001316 antikoerper, Afu5g02030 antikoerper, T9L24.30 antikoerper, T9L24_30 antikoerper, atnudt21 antikoerper, nudix hydrolase homolog 21 antikoerper, nudix hydrolase 21 antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 21 antikoerper, nudix hydrolase 21 L homeolog antikoerper, cleavage and polyadenylation specificity factor subunit 5 antikoerper, cleavage and polyadenylation specific factor 5 antikoerper, autocrine motility factor receptor antikoerper, nudix hydrolase homolog 21 antikoerper, NUDT21 antikoerper, Nudt21 antikoerper, nudt21 antikoerper, nudt21.L antikoerper, ANI_1_1518144 antikoerper, AOR_1_2312154 antikoerper, PTRG_11035 antikoerper, PAAG_04662 antikoerper, MCYG_02022 antikoerper, VDBG_06706 antikoerper, MGYG_04057 antikoerper, cpsf5 antikoerper, PGTG_05353 antikoerper, Tsp_03672 antikoerper, LOC732888 antikoerper, AFUA_5G02030 antikoerper, NFIA_040090 antikoerper, ACLA_003240 antikoerper, CC1G_07993 antikoerper, PMAA_039710 antikoerper, AFLA_025180 antikoerper, TSTA_079060 antikoerper, BDBG_01565 antikoerper, TERG_04393 antikoerper

Hintergrund: NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.

Molekulargewicht: 25 kDa (MW of target protein)