SRP19 Antikörper (Middle Region)
-
- Target Alle SRP19 Antikörper anzeigen
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRP19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SRP19 antibody was raised against the middle region of SRP19
- Aufreinigung
- Purified
- Immunogen
- SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
- Top Product
- Discover our top product SRP19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRP19 Blocking Peptide, catalog no. 33R-4826, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
- Andere Bezeichnung
- SRP19 (SRP19 Produkte)
- Synonyme
- 2310020D23Rik antikoerper, zgc:63961 antikoerper, CG4457 antikoerper, Dmel\\CG4457 antikoerper, SRP19 antikoerper, srp19 antikoerper, signal recognition particle 19 antikoerper, signal recognition particle 19kDa L homeolog antikoerper, signal recognition particle 19kDa antikoerper, Signal recognition particle protein 19 antikoerper, SRP19 antikoerper, srp19.L antikoerper, srp19 antikoerper, Srp19 antikoerper
- Hintergrund
- SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-