DDX39 Antikörper

Produktnummer ABIN629972

Produktdetails anti-DDX39 Antikörper

Target: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX39 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX39 Blocking Peptide, catalog no. 33R-5644, is also available for use as a blocking control in assays to test for specificity of this DDX39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX39

Target: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Andere Bezeichnung: DDX39 (DDX39 Produkte)

Synonyme: 2610307C23Rik antikoerper, BAT1 antikoerper, DDXL antikoerper, Ddx39a antikoerper, URH49 antikoerper, BAT1L antikoerper, DDX39 antikoerper, Ddx39 antikoerper, Ddxl antikoerper, ddx39a antikoerper, wu:fc87b12 antikoerper, zgc:55881 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 antikoerper, DExD-box helicase 39A antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa antikoerper, Ddx39 antikoerper, DDX39A antikoerper, Ddx39a antikoerper, ddx39aa antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.

Molekulargewicht: 47 kDa (MW of target protein)