RRP9 Antikörper (Middle Region)
-
- Target Alle RRP9 Antikörper anzeigen
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RRP9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RRP9 antibody was raised against the middle region of RRP9
- Aufreinigung
- Purified
- Immunogen
- RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
- Top Product
- Discover our top product RRP9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RRP9 Blocking Peptide, catalog no. 33R-4097, is also available for use as a blocking control in assays to test for specificity of this RRP9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
- Andere Bezeichnung
- RRP9 (RRP9 Produkte)
- Synonyme
- Rnu3ip2 antikoerper, RNU3IP2 antikoerper, U3-55K antikoerper, 55kDa antikoerper, D19435 antikoerper, D9Wsu10e antikoerper, U3-55k antikoerper, ribosomal RNA processing 9, U3 small nucleolar RNA binding protein antikoerper, RRP9, small subunit (SSU) processome component, homolog (yeast) antikoerper, Rrp9 antikoerper, RRP9 antikoerper
- Hintergrund
- RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion
-