SYNCRIP Antikörper (N-Term)

Produktnummer ABIN629882

Produktdetails anti-SYNCRIP Antikörper

Target: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYNCRIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SYNCRIP antibody was raised against the N terminal of SYNCRIP

Aufreinigung: Purified

Immunogen: SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SYNCRIP Blocking Peptide, catalog no. 33R-5770, is also available for use as a blocking control in assays to test for specificity of this SYNCRIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNCRIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYNCRIP

Target: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Andere Bezeichnung: SYNCRIP (SYNCRIP Produkte)

Synonyme: GRY-RBP antikoerper, GRYRBP antikoerper, HNRNPQ antikoerper, HNRPQ1 antikoerper, NSAP1 antikoerper, PP68 antikoerper, hnRNP-Q antikoerper, 2610109K23Rik antikoerper, 4632417O19Rik antikoerper, Nsap1 antikoerper, Nsap1l antikoerper, pp68 antikoerper, nsap1 antikoerper, wu:fe02c03 antikoerper, wu:fe47h09 antikoerper, SYNCRIP antikoerper, hnrpq1 antikoerper, gry-rbp antikoerper, rp1-3j17.2 antikoerper, synaptotagmin binding cytoplasmic RNA interacting protein antikoerper, synaptotagmin binding, cytoplasmic RNA interacting protein antikoerper, synaptotagmin binding cytoplasmic RNA interacting protein S homeolog antikoerper, SYNCRIP antikoerper, Syncrip antikoerper, syncrip antikoerper, syncrip.S antikoerper

Hintergrund: Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Molekulargewicht: 69 kDa (MW of target protein)