MMP19 Antikörper (C-Term)
-
- Target Alle MMP19 Antikörper anzeigen
- MMP19 (Matrix Metallopeptidase 19 (MMP19))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MMP19 antibody was raised against the C terminal of MMP19
- Aufreinigung
- Purified
- Immunogen
- MMP19 antibody was raised using the C terminal of MMP19 corresponding to a region with amino acids IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
- Top Product
- Discover our top product MMP19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MMP19 Blocking Peptide, catalog no. 33R-3981, is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP19 (Matrix Metallopeptidase 19 (MMP19))
- Andere Bezeichnung
- MMP19 (MMP19 Produkte)
- Synonyme
- mmp18 antikoerper, mmp-18 antikoerper, mmp-19 antikoerper, col4 antikoerper, MMP18 antikoerper, RASI-1 antikoerper, matrix metallopeptidase 19 antikoerper, matrix metallopeptidase 1 S homeolog antikoerper, mmp19 antikoerper, mmp1.S antikoerper, MMP19 antikoerper, Mmp19 antikoerper
- Hintergrund
- Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of the protein encoded by this gene has not been determined. This gene was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19).
- Molekulargewicht
- 56 kDa (MW of target protein)
-