SERPINB5 Antikörper

Produktnummer ABIN629846

Produktdetails anti-SERPINB5 Antikörper

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB5 Blocking Peptide, catalog no. 33R-6892, is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB5

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Andere Bezeichnung: SERPINB5 (SERPINB5 Produkte)

Synonyme: 1110036M19Rik antikoerper, AI462524 antikoerper, AI646751 antikoerper, Maspin antikoerper, PI-5 antikoerper, Spi7 antikoerper, ovalbumin antikoerper, PI5 antikoerper, maspin antikoerper, Pi5 antikoerper, serine (or cysteine) peptidase inhibitor, clade B, member 5 antikoerper, serpin family B member 5 antikoerper, serpin peptidase inhibitor, clade B (ovalbumin), member 5 S homeolog antikoerper, Serpinb5 antikoerper, SERPINB5 antikoerper, serpinb5.S antikoerper

Hintergrund: As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: p53 Signalweg