NSUN5P2 Antikörper (Middle Region)

Produktnummer ABIN629781

Produktdetails anti-NSUN5P2 Antikörper

Target: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN5P2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSUN5 C antibody was raised against the middle region of NSUN5

Aufreinigung: Purified

Immunogen: NSUN5 C antibody was raised using the middle region of NSUN5 corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN5C Blocking Peptide, catalog no. 33R-6965, is also available for use as a blocking control in assays to test for specificity of this NSUN5C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN5P2

Target: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Andere Bezeichnung: NSUN5C (NSUN5P2 Produkte)

Synonyme: NOL1R2 antikoerper, NSUN5C antikoerper, WBSCR20B antikoerper, WBSCR20C antikoerper, NOP2/Sun RNA methyltransferase family member 5 pseudogene 2 antikoerper, NSUN5P2 antikoerper

Hintergrund: NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.

Molekulargewicht: 34 kDa (MW of target protein)