NAA50 Antikörper (C-Term)
-
- Target Alle NAA50 Antikörper anzeigen
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAA50 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NAT13 antibody was raised against the C terminal of NAT13
- Aufreinigung
- Purified
- Immunogen
- NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
- Top Product
- Discover our top product NAA50 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NAT13 Blocking Peptide, catalog no. 33R-1262, is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
- Andere Bezeichnung
- NAT13 (NAA50 Produkte)
- Synonyme
- MAK3 antikoerper, NAT13 antikoerper, NAT5 antikoerper, SAN antikoerper, hNAT5 antikoerper, hSAN antikoerper, 2600005K24Rik antikoerper, 2810441M03Rik antikoerper, AW112078 antikoerper, Mak3 antikoerper, Mak3p antikoerper, Nat13 antikoerper, Nat5 antikoerper, San antikoerper, DKFZp469M1032 antikoerper, san antikoerper, mak3 antikoerper, nat5 antikoerper, nat13 antikoerper, MGC80671 antikoerper, N(alpha)-acetyltransferase 50, NatE catalytic subunit antikoerper, N(alpha)-acetyltransferase 50, NatE catalytic subunit L homeolog antikoerper, NAA50 antikoerper, Naa50 antikoerper, naa50.L antikoerper
- Hintergrund
- NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.
- Molekulargewicht
- 19 kDa (MW of target protein)
-