TRMT2B Antikörper (Middle Region)

Produktnummer ABIN629778

Produktdetails anti-TRMT2B Antikörper

Target: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRMT2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CXORF34 antibody was raised against the middle region of Cxorf34

Aufreinigung: Purified

Immunogen: CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXORF34 Blocking Peptide, catalog no. 33R-3146, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRMT2B

Target: TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))

Andere Bezeichnung: CXORF34 (TRMT2B Produkte)

Synonyme: CXorf34 antikoerper, dJ341D10.3 antikoerper, 4732479N06Rik antikoerper, im:7160396 antikoerper, wu:fc49d02 antikoerper, zgc:162982 antikoerper, tRNA methyltransferase 2 homolog B antikoerper, TRM2 tRNA methyltransferase 2B antikoerper, TRMT2B antikoerper, Trmt2b antikoerper, trmt2b antikoerper

Hintergrund: CXorf34 is a putative methyltransferase.

Molekulargewicht: 56 kDa (MW of target protein)