AKAP7 Antikörper

Produktnummer ABIN629711

Produktdetails anti-AKAP7 Antikörper

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP7 Blocking Peptide, catalog no. 33R-4914, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP7

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Andere Bezeichnung: AKAP7 (AKAP7 Produkte)

Synonyme: akap15 antikoerper, akap18 antikoerper, MGC83920 antikoerper, AKAP7 antikoerper, AKAP15 antikoerper, AKAP18 antikoerper, 6430401D08 antikoerper, AI662165 antikoerper, Akap18 antikoerper, BB170514 antikoerper, AKAP-18 antikoerper, AKAP18d antikoerper, Akap15 antikoerper, A-kinase anchoring protein 7 antikoerper, A-kinase anchoring protein 7 L homeolog antikoerper, A kinase (PRKA) anchor protein 7 antikoerper, AKAP7 antikoerper, akap7.L antikoerper, akap7 antikoerper, Akap7 antikoerper

Hintergrund: AKAP7 encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations.

Molekulargewicht: 36 kDa (MW of target protein)