SCD Antikörper

Produktnummer ABIN629709

Produktdetails anti-SCD Antikörper

Target: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCD Blocking Peptide, catalog no. 33R-3805, is also available for use as a blocking control in assays to test for specificity of this SCD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCD

Target: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Andere Bezeichnung: SCD (SCD Produkte)

Synonyme: FADS5 antikoerper, MSTP008 antikoerper, SCD1 antikoerper, SCDOS antikoerper, AA589638 antikoerper, AI265570 antikoerper, Scd antikoerper, Scd-1 antikoerper, ab antikoerper, SCD antikoerper, fads5 antikoerper, scd1 antikoerper, scdos antikoerper, F27J15.17 antikoerper, F27J15_17 antikoerper, STOMATAL CYTOKINESIS-DEFECTIVE 1 antikoerper, cds2 antikoerper, desaturase antikoerper, stearoyl-CoA desaturase antikoerper, acyl-CoA desaturase antikoerper, Acyl-CoA desaturase antikoerper, stearoyl-Coenzyme A desaturase 1 antikoerper, stearoyl-CoA desaturase (delta-9-desaturase) antikoerper, stearoyl-CoA desaturase (delta-9-desaturase) S homeolog antikoerper, stomatal cytokinesis defective / SCD1 protein (SCD1) antikoerper, acyl-CoA desaturase-like antikoerper, SCD antikoerper, CIMG_08158 antikoerper, VIBHAR_RS23280 antikoerper, acod antikoerper, Scd1 antikoerper, Scd antikoerper, scd antikoerper, LOC100346561 antikoerper, scd.S antikoerper, SCD1 antikoerper, LOC100719661 antikoerper, LOC101835884 antikoerper, LOC109101093 antikoerper

Hintergrund: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation