NFS1 Antikörper

Produktnummer ABIN629670

Produktdetails anti-NFS1 Antikörper

Target: NFS1 (NFS1, Cysteine Desulfurase (NFS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NFS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Anwendungsinformationen

Applikationshinweise: WB: 0.3125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NFS1 Blocking Peptide, catalog no. 33R-9331, is also available for use as a blocking control in assays to test for specificity of this NFS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NFS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NFS1

Target: NFS1 (NFS1, Cysteine Desulfurase (NFS1))

Andere Bezeichnung: NFS1 (NFS1 Produkte)

Synonyme: ARABIDOPSIS THALIANA NITROGEN FIXATION S (NIFS)-LIKE 1 antikoerper, ATNFS1 antikoerper, ATNIFS1 antikoerper, CYSTEINE DESULFURASE antikoerper, MPA24.7 antikoerper, MPA24_7 antikoerper, NIFS1 antikoerper, NITROGEN FIXATION S HOMOLOG 1 antikoerper, nitrogen fixation S (NIFS)-like 1 antikoerper, IscS antikoerper, NIFS antikoerper, Nifs antikoerper, NFS1 antikoerper, AA987187 antikoerper, m-Nfs1 antikoerper, m-Nfsl antikoerper, fb50g03 antikoerper, wu:fb50g03 antikoerper, aminotransferase family protein (LolT) antikoerper, cysteine desulfurase, (m-Nfs1) antikoerper, nitrogen fixation S (NIFS)-like 1 antikoerper, cysteine desulfurase antikoerper, NFS1, cysteine desulfurase antikoerper, NFS1 cysteine desulfurase antikoerper, nitrogen fixation gene 1 (S. cerevisiae) antikoerper, AOR_1_546014 antikoerper, trd_A0109 antikoerper, NFS1 antikoerper, Arnit_0871 antikoerper, Fbal_3329 antikoerper, Nfs1 antikoerper, nfs1 antikoerper

Hintergrund: Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this geneupplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis