SETD7 Antikörper
-
- Target Alle SETD7 Antikörper anzeigen
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SETD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SETD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
- Top Product
- Discover our top product SETD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SETD7 Blocking Peptide, catalog no. 33R-7322, is also available for use as a blocking control in assays to test for specificity of this SETD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))
- Andere Bezeichnung
- SETD7 (SETD7 Produkte)
- Synonyme
- KMT7 antikoerper, SET7 antikoerper, SET7/9 antikoerper, SET9 antikoerper, set7 antikoerper, zgc:101860 antikoerper, zgc:92330 antikoerper, 1600028F23Rik antikoerper, H3K4MT antikoerper, Set7 antikoerper, Set7/9 antikoerper, mKIAA1717 antikoerper, SET domain containing lysine methyltransferase 7 antikoerper, SET domain containing (lysine methyltransferase) 7 antikoerper, SETD7 antikoerper, setd7 antikoerper, Setd7 antikoerper
- Hintergrund
- SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.
- Molekulargewicht
- 41 kDa (MW of target protein)
-