SETD7 Antikörper

Produktnummer ABIN629619

Produktdetails anti-SETD7 Antikörper

Target: SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SETD7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SETD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SETD7 Blocking Peptide, catalog no. 33R-7322, is also available for use as a blocking control in assays to test for specificity of this SETD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SETD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SETD7

Target: SETD7 (SET Domain Containing (Lysine Methyltransferase) 7 (SETD7))

Andere Bezeichnung: SETD7 (SETD7 Produkte)

Synonyme: KMT7 antikoerper, SET7 antikoerper, SET7/9 antikoerper, SET9 antikoerper, set7 antikoerper, zgc:101860 antikoerper, zgc:92330 antikoerper, 1600028F23Rik antikoerper, H3K4MT antikoerper, Set7 antikoerper, Set7/9 antikoerper, mKIAA1717 antikoerper, SET domain containing lysine methyltransferase 7 antikoerper, SET domain containing (lysine methyltransferase) 7 antikoerper, SETD7 antikoerper, setd7 antikoerper, Setd7 antikoerper

Hintergrund: SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.

Molekulargewicht: 41 kDa (MW of target protein)