NUDT12 Antikörper
-
- Target Alle NUDT12 Antikörper anzeigen
- NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUDT12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ
- Top Product
- Discover our top product NUDT12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUDT12 Blocking Peptide, catalog no. 33R-4782, is also available for use as a blocking control in assays to test for specificity of this NUDT12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))
- Andere Bezeichnung
- NUDT12 (NUDT12 Produkte)
- Synonyme
- 0610016O18Rik antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 12 antikoerper, peroxisomal NADH pyrophosphatase NUDT12 antikoerper, NADH pyrophosphatase antikoerper, nudix hydrolase 12 antikoerper, nudt12 antikoerper, BCAN_A0038 antikoerper, BSUIS_A0039 antikoerper, SJAG_03091 antikoerper, BMEA_A0038 antikoerper, PAAG_04340 antikoerper, MCYG_01870 antikoerper, MGYG_04196 antikoerper, NUDT12 antikoerper, Nudt12 antikoerper
- Hintergrund
- Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.
- Molekulargewicht
- 52 kDa (MW of target protein)
-