PRIM2 Antikörper

Produktnummer ABIN629585

Produktdetails anti-PRIM2 Antikörper

Target: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRIM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PRIM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRIM2 Blocking Peptide, catalog no. 33R-7496, is also available for use as a blocking control in assays to test for specificity of this PRIM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRIM2

Target: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Andere Bezeichnung: PRIM2 (PRIM2 Produkte)

Synonyme: prim2a antikoerper, AI323589 antikoerper, Pola3 antikoerper, PRIM2A antikoerper, p58 antikoerper, DNA primase subunit 2 antikoerper, DNA primase, p58 subunit antikoerper, prim2 antikoerper, Prim2 antikoerper, PRIM2 antikoerper

Hintergrund: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interaktom