LYZL6 Antikörper

Produktnummer ABIN599863

Produktdetails anti-LYZL6 Antikörper

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYZL6 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Spezifität: Recognizes human Lysozyme-like 6.

Homologie: Percent identity by BLAST analysis: Human, Gorilla (100%) Gibbon (97%) Monkey, Marmoset (90%).

Aufreinigung: Immunoaffinity purified

Immunogen: Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP. Percent identity by BLAST analysis: Human, Gorilla (100%), Gibbon (97%), Monkey, Marmoset (90%).

Type of Immunogen: Recombinant protein

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Approved: IHC, IHC-P

Usage: Suitable for use in Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferous ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: PBS,  pH 7.2, 40 % glycerol, 0.02 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 1 year at -20°C.

Details zu LYZL6

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Andere Bezeichnung: LYZL6 (LYZL6 Produkte)

Synonyme: LYC1 antikoerper, PRO1485 antikoerper, TKAL754 antikoerper, UNQ754 antikoerper, 1700023H08Rik antikoerper, Lyc1 antikoerper, RGD1306968 antikoerper, lysozyme like 6 antikoerper, lysozyme-like protein 6 antikoerper, lysozyme-like 6 antikoerper, LYZL6 antikoerper, LOC480492 antikoerper, Lyzl6 antikoerper

Hintergrund: Name/Gene ID: LYZL6

Synonyms: LYZL6, LYC1, Lysozyme homolog, PRO1485, Lysozyme-like 6, Lysozyme-like protein 6, TKAL754, UNQ754

Gen-ID: 57151

UniProt: O75951