PEBP1 Antikörper

Produktnummer ABIN5708350

Produktdetails anti-PEBP1 Antikörper

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RKIP antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the RKIP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Andere Bezeichnung: RKIP / PEBP1 / PBP (PEBP1 Produkte)

Synonyme: HCNP antikoerper, HCNPpp antikoerper, PBP antikoerper, PEBP antikoerper, PEBP-1 antikoerper, RKIP antikoerper, pbp antikoerper, hcnp antikoerper, pebp antikoerper, rkip antikoerper, Pbp antikoerper, Pbp1 antikoerper, Pbpr antikoerper, Rkip antikoerper, PEBP1 antikoerper, BcDNA:LP12095 antikoerper, CG18594 antikoerper, Dmel\\CG18594 antikoerper, T2 antikoerper, zgc:56033 antikoerper, zgc:76942 antikoerper, phosphatidylethanolamine binding protein 1 antikoerper, phosphatidylethanolamine binding protein 1 L homeolog antikoerper, phosphatidylethanolamine-binding protein antikoerper, phosphatidylethanolamine-binding protein,putative antikoerper, Phosphatidylethanolamine-binding protein 1 antikoerper, PEBP1 antikoerper, pebp1 antikoerper, Pebp1 antikoerper, pebp1.L antikoerper, RR_RS07785 antikoerper, PVX_235290 antikoerper, PVX_123630 antikoerper, PKH_143640 antikoerper, EAM_1207 antikoerper

Hintergrund: PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.

UniProt: P30086

Pathways: Feeding Behaviour