-
- Target Alle STAR Antikörper anzeigen
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Kreuzreaktivität (Details)
- Expected species reactivity: Human
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product STAR Primärantikörper
-
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 39-108) antibody
STAR Reaktivität: Human IHC, StM Wirt: Maus Monoclonal STAR-2154 unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 81-180) antibodySTAR Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 5F9 unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 1-285) antibodySTAR Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 101-200) antibodySTAR Reaktivität: Human, Maus, Ratte, Huhn, Schaf WB, IF (cc), IF (p), IHC (p), FACS, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) antibodySTAR Reaktivität: Human WB, IF, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 39-108) antibodySTAR Reaktivität: Human IHC, StM Wirt: Maus Monoclonal STAR-2140 unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) antibodySTAR Reaktivität: Human, Maus, Ratte IF Wirt: Kaninchen Polyclonal unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 64-285) antibodySTAR Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Steroidogenic Acute Regulatory Protein (STAR) antibodySTAR Reaktivität: Human IHC Wirt: Kaninchen Monoclonal MSVA-740R unconjugated Recombinant Antibody
anti-Steroidogenic Acute Regulatory Protein (STAR) (AA 64-285) antibodySTAR Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal dilution of the StAR antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the StAR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
- Andere Bezeichnung
- StAR / Steroidogenic acute regulatory protein (STAR Produkte)
- Synonyme
- STARD1 antikoerper, AV363654 antikoerper, D8Ertd419e antikoerper, star antikoerper, LOC100219165 antikoerper, StARD1 antikoerper, steroidogenic acute regulatory protein antikoerper, steroidogenic acute regulatory protein L homeolog antikoerper, STAR antikoerper, Star antikoerper, star antikoerper, star.L antikoerper
- Hintergrund
- The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
- UniProt
- P49675
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis
-
Sie sind hier:
