KCNH1 Antikörper
-
- Target Alle KCNH1 Antikörper anzeigen
- KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- AKRKSWARFK DACGKSEDWN KVSKAESMET LPERTKA
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for KCNH1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).
- Top Product
- Discover our top product KCNH1 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))
- Andere Bezeichnung
- KCNH1 (KCNH1 Produkte)
- Synonyme
- EAG antikoerper, bEAG antikoerper, EAG1 antikoerper, Kv10.1 antikoerper, h-eag antikoerper, M-eag antikoerper, Eag1 antikoerper, kcnh1 antikoerper, potassium voltage-gated channel subfamily H member 1 antikoerper, potassium channel, voltage gated eag related subfamily H, member 1 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 1 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 1a antikoerper, KCNH1 antikoerper, LOC490277 antikoerper, Kcnh1 antikoerper, kcnh1a antikoerper
- Hintergrund
-
Synonyms: Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1
Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
Background: Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
- UniProt
- O95259
-