MUC2 Antikörper

Produktnummer ABIN5693242

Produktdetails anti-MUC2 Antikörper

Target: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUC2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Sequenz: DDFKTASGLV EATGAGFANT WKAQSTCHDK LDWLDD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for MUC2 detection. Tested with IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu MUC2

Target: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Andere Bezeichnung: MUC2 (MUC2 Produkte)

Synonyme: 2010015E03Rik antikoerper, MCM antikoerper, wnn antikoerper, MLP antikoerper, MUC-2 antikoerper, SMUC antikoerper, HH-Muc antikoerper, mucin 2 antikoerper, mucin 2, oligomeric mucus/gel-forming antikoerper, mucin-2 antikoerper, Muc2 antikoerper, MUC2 antikoerper, LOC100724045 antikoerper

Hintergrund:

Synonyms: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC

Tissue Specificity: Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.

Background: Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80 % by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.

UniProt: Q02817