Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

DC-SIGN/CD209 Antikörper

CD209 Reaktivität: Human, Maus, Ratte WB, FACS, IHC, ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5693101
  • Target Alle DC-SIGN/CD209 (CD209) Antikörper anzeigen
    DC-SIGN/CD209 (CD209) (CD209)
    Reaktivität
    • 104
    • 28
    • 23
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 75
    • 45
    • 2
    • 1
    Kaninchen
    Klonalität
    • 74
    • 49
    Polyklonal
    Konjugat
    • 56
    • 10
    • 10
    • 7
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser DC-SIGN/CD209 Antikörper ist unkonjugiert
    Applikation
    • 74
    • 47
    • 34
    • 33
    • 27
    • 13
    • 7
    • 7
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Marke
    Picoband™
    Sequenz
    MSDSKEPRLQ QLGLLEEEQL RGLGFRQTRG YKSLA
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for DC-SIGN detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
    Immunogen
    A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
    Top Product
    Discover our top product CD209 Primärantikörper
  • Applikationshinweise

    Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

    Application Details: Western blot, 0.1-0.5 μg/mL
    Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
    Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
    Immunocytochemistry, 0.5-1 μg/mL, Human
    Flow Cytometry, 1-3 μg/1x106 cells, Human

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
  • Target
    DC-SIGN/CD209 (CD209) (CD209)
    Andere Bezeichnung
    CD209 (CD209 Produkte)
    Synonyme
    CDSIGN antikoerper, CLEC4L antikoerper, DC-SIGN antikoerper, DC-SIGN1 antikoerper, cd209 antikoerper, CLEC4M antikoerper, si:ch211-224h1.3 antikoerper, CD209 antikoerper, CIRE antikoerper, Dcsign antikoerper, SIGN-R1 antikoerper, SIGNR5 antikoerper, Cd209 antikoerper, CD209 molecule antikoerper, CD209a antigen antikoerper, CD209 antigen-like protein D antikoerper, CD209c molecule antikoerper, CD209 antigen antikoerper, CD209 antikoerper, cd209 antikoerper, Cd209a antikoerper, LOC100529184 antikoerper, Cd209c antikoerper, LOC100460708 antikoerper, LOC105484282 antikoerper
    Hintergrund

    Synonyms: CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1, CD209, CD209, CLEC4L

    Tissue Specificity: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.

    Background: DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Sie sind hier:
Kundenservice