STAR Antikörper

Produktnummer ABIN5693042

Produktdetails anti-STAR Antikörper

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STAR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: EETLYSDQEL AYLQQGEEAM QKALGILSNQ EGWKKESQQD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for StAR detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human StAR (EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu STAR

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Andere Bezeichnung: STAR (STAR Produkte)

Synonyme: STARD1 antikoerper, AV363654 antikoerper, D8Ertd419e antikoerper, star antikoerper, LOC100219165 antikoerper, StARD1 antikoerper, steroidogenic acute regulatory protein antikoerper, steroidogenic acute regulatory protein L homeolog antikoerper, STAR antikoerper, Star antikoerper, star antikoerper, star.L antikoerper

Hintergrund:

Synonyms: Steroidogenic acute regulatory protein, mitochondrial, StAR, START domain-containing protein 1, StARD1, STAR, STARD1

Tissue Specificity: Expressed in gonads, adrenal cortex and kidney.

Background: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

UniProt: P49675

Pathways: Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis