SLC31A1 Antikörper

Produktnummer ABIN5693022

Produktdetails anti-SLC31A1 Antikörper

Target: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC31A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: NGTILMETHK TVGQQMLSFP HLLQTVLHII Q

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SLC31A1/CTR1 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu SLC31A1

Target: SLC31A1 (Solute Carrier Family 31 (Copper Transporters), Member 1 (SLC31A1))

Andere Bezeichnung: SLC31A1 (SLC31A1 Produkte)

Synonyme: SLC31A1 antikoerper, Xctr1 antikoerper, copt1 antikoerper, ctr1 antikoerper, hctr1 antikoerper, K19M22.24 antikoerper, copper transporter 1 antikoerper, Slc31a1 antikoerper, COPT1 antikoerper, CTR1 antikoerper, Ctr1 antikoerper, LRRGT00200 antikoerper, ctr-1 antikoerper, zgc:76839 antikoerper, 4930445G01Rik antikoerper, AI787263 antikoerper, AU016967 antikoerper, solute carrier family 31 member 1 antikoerper, copper transporter 1 antikoerper, solute carrier family 31 (copper transporter), member 1 antikoerper, solute carrier family 31, member 1 antikoerper, SLC31A1 antikoerper, LOC100281410 antikoerper, LOC100286321 antikoerper, slc31a1 antikoerper, COPT1 antikoerper, Slc31a1 antikoerper

Hintergrund:

Synonyms: High affinity copper uptake protein 1, Copper transporter 1, hCTR1, Solute carrier family 31 member 1, SLC31A1, COPT1, CTR1

Background: High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

UniProt: O15431