ABR Antikörper

Produktnummer ABIN5647965

Produktdetails anti-ABR Antikörper

Target: ABR (Active BCR-Related (ABR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the ABR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ABR

Target: ABR (Active BCR-Related (ABR))

Andere Bezeichnung: ABR / Active BCR related (ABR Produkte)

Synonyme: MDB antikoerper, xabr antikoerper, 6330400K15Rik antikoerper, AU042359 antikoerper, active BCR-related antikoerper, active BCR-related L homeolog antikoerper, active BCR-related gene antikoerper, ABR antikoerper, abr.L antikoerper, Abr antikoerper

Hintergrund: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

UniProt: Q12979

Pathways: Neurotrophin Signalübertragung, Regulation of Leukocyte Mediated Immunity