ITLN1/Omentin Antikörper

Produktnummer ABIN5647892

Produktdetails anti-ITLN1/Omentin Antikörper

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITLN1/Omentin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the ITLN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ITLN1/Omentin

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Andere Bezeichnung: ITLN1 / Intelectin-1 (ITLN1 Produkte)

Synonyme: IntL antikoerper, Itln antikoerper, Itln2 antikoerper, Itln5 antikoerper, Itlna antikoerper, Lfr antikoerper, HL-1 antikoerper, HL1 antikoerper, INTL antikoerper, ITLN antikoerper, LFR antikoerper, hIntL antikoerper, omentin antikoerper, LfR antikoerper, Xeel antikoerper, hl-1 antikoerper, hl1 antikoerper, intl antikoerper, itln antikoerper, itln1 antikoerper, lfr antikoerper, xeel antikoerper, INTL1 antikoerper, zgc:153267 antikoerper, intelectin 1 (galactofuranose binding) antikoerper, intelectin 1 antikoerper, intelectin 1 L homeolog antikoerper, Itln1 antikoerper, ITLN1 antikoerper, itln1.L antikoerper, itln1 antikoerper

Hintergrund: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

UniProt: Q8WWA0