L1CAM Antikörper

Produktnummer ABIN5647757

Produktdetails anti-L1CAM Antikörper

Target: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser L1CAM Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the L1CAM antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the L1CAM antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu L1CAM

Target: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Andere Bezeichnung: L1CAM / NCAM-L1 / CD171 (L1CAM Produkte)

Synonyme: l1cam-a antikoerper, CAML1 antikoerper, CD171 antikoerper, HSAS antikoerper, HSAS1 antikoerper, MASA antikoerper, MIC5 antikoerper, N-CAM-L1 antikoerper, N-CAML1 antikoerper, NCAM-L1 antikoerper, S10 antikoerper, SPG1 antikoerper, L1 antikoerper, Hsas antikoerper, Hyd antikoerper, NCAML1 antikoerper, L1 cell adhesion molecule S homeolog antikoerper, L1 cell adhesion molecule antikoerper, l1cam.S antikoerper, L1CAM antikoerper, L1cam antikoerper

Hintergrund: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.

UniProt: P32004

Pathways: Synaptic Membrane