IBSP Antikörper

Produktnummer ABIN5647643

Produktdetails anti-IBSP Antikörper

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IBSP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ were used as the immunogen for the IBSP antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IBSP antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IBSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IBSP

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Andere Bezeichnung: IBSP / Bone Sialoprotein 2 (IBSP Produkte)

Synonyme: BNSP antikoerper, BSP antikoerper, BSP-II antikoerper, SP-II antikoerper, Bsp antikoerper, BSP II antikoerper, BSPII antikoerper, Bsp2 antikoerper, IBSP antikoerper, integrin binding sialoprotein antikoerper, integrin-binding sialoprotein antikoerper, integrin-binding sialoprotein S homeolog antikoerper, IBSP antikoerper, Ibsp antikoerper, ibsp.S antikoerper, ibsp antikoerper

Hintergrund: IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.

UniProt: P21815