ABCB10 Antikörper (AA 640-678)

Produktnummer ABIN5647439

Produktdetails anti-ABCB10 Antikörper

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Bindungsspezifität: AA 640-678

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ABCB10

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Andere Bezeichnung: ABCB10 (ABCB10 Produkte)

Synonyme: EST20237 antikoerper, M-ABC2 antikoerper, MTABC2 antikoerper, Abc-me antikoerper, Abcb12 antikoerper, ABCB10 antikoerper, si:dkey-162b3.3 antikoerper, GB10581 antikoerper, ATP binding cassette subfamily B member 10 antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 10 antikoerper, ATP-binding cassette sub-family B member 10, mitochondrial antikoerper, ABCB10 antikoerper, Abcb10 antikoerper, abcb10 antikoerper, LOC552744 antikoerper

Hintergrund: ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

UniProt: Q9NRK6