FDCSP Antikörper (AA 18-51)

Produktnummer ABIN5647429

Produktdetails anti-FDCSP Antikörper

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Bindungsspezifität: AA 18-51

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FDCSP Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FDCSP antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FDCSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu FDCSP

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Andere Bezeichnung: FDCSP (C4orf7 Produkte)

Synonyme: FDC-SP antikoerper, C4orf7 antikoerper, cDNA sequence BC037156 antikoerper, follicular dendritic cell secreted protein antikoerper, BC037156 antikoerper, FDCSP antikoerper

Hintergrund: FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

UniProt: Q8NFU4