AMHR2 Antikörper
-
- Target Alle AMHR2 Antikörper anzeigen
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AMHR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product AMHR2 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Prior to reconstitution, store at 4°C. After reconstitution, the AMHR2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
- Andere Bezeichnung
- AMHR2 (AMHR2 Produkte)
- Synonyme
- AMHR antikoerper, MISR2 antikoerper, MISRII antikoerper, MRII antikoerper, Misiir antikoerper, Misrii antikoerper, Mrii antikoerper, anti-Mullerian hormone receptor type 2 antikoerper, anti-Mullerian hormone type 2 receptor antikoerper, AMHR2 antikoerper, Amhr2 antikoerper
- Substanzklasse
- Antibody
- Hintergrund
- AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
- UniProt
- Q16671
-