Cyclin T1 Antikörper
-
- Target Alle Cyclin T1 (CCNT1) Antikörper anzeigen
- Cyclin T1 (CCNT1)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cyclin T1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM from the human protein were used as the immunogen for the Cyclin T1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product CCNT1 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Prior to reconstitution, store at 4°C. After reconstitution, the Cyclin T1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Cyclin T1 (CCNT1)
- Andere Bezeichnung
- Cyclin T1 (CCNT1 Produkte)
- Synonyme
- CG6292 antikoerper, Dmcyclin T antikoerper, Dmel\\CG6292 antikoerper, ORE-14 antikoerper, P-TEFb antikoerper, anon-74EFc antikoerper, dT antikoerper, p124 antikoerper, Cyclin-T1 antikoerper, ccnt antikoerper, cyct1 antikoerper, CCNT antikoerper, CYCT1 antikoerper, HIVE1 antikoerper, 2810478G24Rik antikoerper, AI115585 antikoerper, CycT1 antikoerper, fi75b02 antikoerper, si:dkey-18f23.10 antikoerper, wu:fi75b02 antikoerper, Cyclin T antikoerper, cyclin T1 antikoerper, cyclin T1 L homeolog antikoerper, CycT antikoerper, CCNT1 antikoerper, ccnt1 antikoerper, Ccnt1 antikoerper, ccnt1.L antikoerper
- Hintergrund
- Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
- UniProt
- O60563
-