ASL Antikörper

Produktnummer ABIN5518971

Produktdetails anti-ASL Antikörper

Target: ASL (Argininosuccinate Lyase (ASL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: YTHLQRAQPI RWSHWILSHA VALTRDSERL LEVRKRIN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: argininosuccinate lyase
Protein Name: Argininosuccinate lyase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ASL

Target: ASL (Argininosuccinate Lyase (ASL))

Andere Bezeichnung: ASL (ASL Produkte)

Synonyme: ASAL antikoerper, 2510006M18Rik antikoerper, zgc:63532 antikoerper, BA4879 antikoerper, PSPTO0125 antikoerper, Adl antikoerper, Asl antikoerper, argininosuccinate lyase antikoerper, argininosuccinate lyase ArgH antikoerper, adenylosuccinate lyase antikoerper, argininosuccinate lyase L homeolog antikoerper, ASL antikoerper, Asl antikoerper, asl antikoerper, argH2 antikoerper, argH antikoerper, arg7 antikoerper, CNC04420 antikoerper, STHERM_c13370 antikoerper, Adsl antikoerper, asl.L antikoerper, ARG7 antikoerper

Hintergrund: ASL (argininosuccinatelyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.

Synonyms: Argininosuccinate lyase, ASAL, Arginosuccinase, ASL

Gen-ID: 435

UniProt: P04424

Pathways: Response to Growth Hormone Stimulus