OLR1 Antikörper (Middle Region)

Produktnummer ABIN5518941

Produktdetails anti-OLR1 Antikörper

Target: OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))

Bindungsspezifität: AA 162-197, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.

Sequenz: SFNWEKSQEK CLSLDAKLLK INSTADLDFI QQAISY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Oxidized low-density lipoprotein receptor 1(OLR1) detection. Tested with WB in Human.
Gene Name: oxidized low density lipoprotein receptor 1
Protein Name: Oxidized low-density lipoprotein receptor 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu OLR1

Target: OLR1 (Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1 (OLR1))

Andere Bezeichnung: OLR1 (OLR1 Produkte)

Synonyme: OLR1 antikoerper, LOX1 antikoerper, Olr1 antikoerper, CLEC8A antikoerper, LOXIN antikoerper, SCARE1 antikoerper, SLOX1 antikoerper, LOX-1 antikoerper, SR-EI antikoerper, Scare1 antikoerper, Oldlr1 antikoerper, Oldr1 antikoerper, PLOX-1 antikoerper, oxidized low density lipoprotein receptor 1 antikoerper, oxidized low density lipoprotein (lectin-like) receptor 1 antikoerper, OLR1 antikoerper, Olr1 antikoerper

Hintergrund: OLR1(oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression, however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD.

Synonyms: Oxidized low-density lipoprotein receptor 1, Ox-LDL receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, LOX-1, Lectin-like oxLDL receptor 1, hLOX-1, Lectin-type oxidized LDL receptor 1, Oxidized low-density lipoprotein receptor 1, soluble form, OLR1, CLEC8A, LOX1

Gen-ID: 4973

UniProt: P78380