PIK3CB Antikörper (Middle Region)

Produktnummer ABIN5518862

Produktdetails anti-PIK3CB Antikörper

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Bindungsspezifität: AA 556-598, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIK3CB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DLIWTLRQDC REIFPQSLPK LLLSIKWNKL EDVAQLQALL QIW

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
Protein Name: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-PIK3CB Antikörper (ABIN5518862)

Mu, Ma, Shi, Zhen: "The expression of S100B protein in serum of patients with brain metastases from small-cell lung cancer and its clinical significance." in: Oncology letters, Vol. 14, Issue 6, pp. 7107-7110, (2017) (PubMed).

Wang, Sun, Li, Dong, Li, Zhao: "Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." in: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).

Details zu PIK3CB

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Andere Bezeichnung: PIK3CB (PIK3CB Produkte)

Synonyme: P110BETA antikoerper, PI3K antikoerper, PI3KBETA antikoerper, PIK3C1 antikoerper, fb92a07 antikoerper, wu:fb92a07 antikoerper, 1110001J02Rik antikoerper, AI447572 antikoerper, p110beta antikoerper, PI3Kbeta antikoerper, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta antikoerper, phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta antikoerper, PIK3CB antikoerper, pik3cb antikoerper, Pik3cb antikoerper

Hintergrund: Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.

Synonyms: p110 BETA | p110Beta | PI3K | PI3K beta | PI3K-beta | PI3Kbeta | PI3KCB | PIK3C1 | Pik3cb | P42338

Gen-ID: 5291

UniProt: P42338