CXCR4 Antikörper (C-Term)

Produktnummer ABIN5518822

Produktdetails anti-CXCR4 Antikörper

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Bindungsspezifität: AA 265-294, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXCR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.

Sequenz: ILLEIIKQGC EFENTVHKWI SITEALAFFH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.
Gene Name: chemokine (C-X-C motif) receptor 4
Protein Name: C-X-C chemokine receptor type 4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-CXCR4 Antikörper (ABIN5518822)

Zhu, Sun, Tan, Xu, Dai, Wang, Fan, Zhou: "Tacrolimus promotes hepatocellular carcinoma and enhances CXCR4/SDF‑1α expression in vivo." in: Molecular medicine reports, Vol. 10, Issue 2, pp. 585-92, (2015) (PubMed).

Zhang, Qi, Li, Zhang, Xu, Wang, Sun: "Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer." in: Journal of experimental & clinical cancer research : CR, Vol. 27, pp. 62, (2009) (PubMed).

Details zu CXCR4

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Andere Bezeichnung: CXCR4 (CXCR4 Produkte)

Synonyme: CD184 antikoerper, D2S201E antikoerper, FB22 antikoerper, HM89 antikoerper, HSY3RR antikoerper, LAP3 antikoerper, LCR1 antikoerper, LESTR antikoerper, NPY3R antikoerper, NPYR antikoerper, NPYRL antikoerper, NPYY3R antikoerper, WHIM antikoerper, Cmkar4 antikoerper, PB-CKR antikoerper, PBSF/SDF-1 antikoerper, Sdf1r antikoerper, CXC-R4-B antikoerper, CXCR-4-B antikoerper, cd184 antikoerper, cxcr4 antikoerper, fb22 antikoerper, hm89 antikoerper, hsy3rr antikoerper, lap3 antikoerper, lcr1 antikoerper, lestr antikoerper, npy3r antikoerper, npyr antikoerper, npyrl antikoerper, npyy3r antikoerper, xcxcr4 antikoerper, CXC-R4 antikoerper, CXCR-4 antikoerper, d2s201e antikoerper, whim antikoerper, CXC-R4-A antikoerper, CXCR-4-A antikoerper, xCXCR4 antikoerper, CXCR4 antikoerper, cb403 antikoerper, zgc:109863 antikoerper, cb824 antikoerper, C-X-C motif chemokine receptor 4 antikoerper, chemokine (C-X-C motif) receptor 4 antikoerper, C-X-C motif chemokine receptor 4 S homeolog antikoerper, C-X-C chemokine receptor type 4 antikoerper, C-X-C motif chemokine receptor 4 L homeolog antikoerper, chemokine (C-X-C motif), receptor 4b antikoerper, chemokine (C-X-C motif) receptor 4a antikoerper, CXCR4 antikoerper, Cxcr4 antikoerper, cxcr4.S antikoerper, cxcr4 antikoerper, LOC100049444 antikoerper, cxcr4.L antikoerper, cxcr4b antikoerper, cxcr4a antikoerper

Hintergrund: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Synonyms: C-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073

Gen-ID: 7852

UniProt: P61073

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events