MMP11 Antikörper (N-Term)
-
- Target Alle MMP11 Antikörper anzeigen
- MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))
-
Bindungsspezifität
- AA 104-135, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- RWEKTDLTYR ILRFPWQLVQ EQVRQTMAEA LK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: matrix metallopeptidase 11
Protein Name: Stromelysin-3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MMP11 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Gene expression profile analyze the molecular mechanism of CXCR7 regulating papillary thyroid carcinoma growth and metastasis." in: Journal of experimental & clinical cancer research : CR, Vol. 34, pp. 16, (2015) (PubMed).
: "
-
Gene expression profile analyze the molecular mechanism of CXCR7 regulating papillary thyroid carcinoma growth and metastasis." in: Journal of experimental & clinical cancer research : CR, Vol. 34, pp. 16, (2015) (PubMed).
-
- Target
- MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))
- Andere Bezeichnung
- MMP11 (MMP11 Produkte)
- Synonyme
- SL-3 antikoerper, ST3 antikoerper, STMY3 antikoerper, Stmy3 antikoerper, MMP-11 antikoerper, matrix metallopeptidase 11 antikoerper, matrix metallopeptidase 11 L homeolog antikoerper, stromelysin-3 antikoerper, MMP11 antikoerper, Mmp11 antikoerper, mmp11.L antikoerper, LOC103694874 antikoerper
- Hintergrund
-
Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.
Synonyms: MMP-11 | Mmp11 | SL 3 | SL-3 | SL3 | ST3 | STMY3 | Stromelysin 3 | Stromelysin III | Stromelysin-3 | P24347 - Gen-ID
- 4320
- UniProt
- P24347
-