MC3R Antikörper (N-Term)

Produktnummer ABIN5518775

Produktdetails anti-MC3R Antikörper

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Bindungsspezifität: AA 91-121, N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MC3R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection. Tested with WB in Human,Mouse.

Sequenz: NALETIMIAI VHSDYLTFED QFIQHMDNIF D

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection. Tested with WB in Human,Mouse.
Gene Name: melanocortin 3 receptor
Protein Name: Melanocortin receptor 3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MC3R

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Andere Bezeichnung: MC3R (MC3R Produkte)

Synonyme: zgc:194235 antikoerper, MC3-R antikoerper, BMIQ9 antikoerper, MC3 antikoerper, OB20 antikoerper, OQTL antikoerper, melanocortin 3 receptor antikoerper, mc3r antikoerper, MC3R antikoerper, Mc3r antikoerper

Hintergrund: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.

Synonyms: BMIQ9 | MC3 | MC3 R | MC3-R | Mc3r | OB20 | OQTL | P41968

Gen-ID: 4159

UniProt: P41968

Pathways: cAMP Metabolic Process