Superoxide dismutase copper chaperone Antikörper (C-Term)

Produktnummer ABIN5518744

Produktdetails anti-Superoxide dismutase copper chaperone Antikörper

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Bindungsspezifität: AA 174-209, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Superoxide dismutase copper chaperone Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DADGRAIFRM EDEQLKVWDV IGRSLIIDEG EDDLGR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: copper chaperone for superoxide dismutase
Protein Name: Copper chaperone for superoxide dismutase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Superoxide dismutase copper chaperone

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Andere Bezeichnung: CCS (CCS Produkte)

Synonyme: ccs antikoerper, MGC82563 antikoerper, CCS antikoerper, DDBDRAFT_0189222 antikoerper, DDBDRAFT_0238038 antikoerper, DDB_0189222 antikoerper, DDB_0238038 antikoerper, ATCCS antikoerper, COPPER/ZINC SUPEROXIDE DISMUTASE COPPER CHAPERONE antikoerper, F5O11.26 antikoerper, F5O11_26 antikoerper, copper chaperone for SOD1 antikoerper, Ccsd antikoerper, copper chaperone for superoxide dismutase L homeolog antikoerper, copper chaperone for superoxide dismutase antikoerper, copper chaperone for SOD1 antikoerper, ccs.L antikoerper, ccs antikoerper, CCS antikoerper, LOC552629 antikoerper, Ccs antikoerper

Hintergrund: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

Synonyms: CCS | SOD 4 | SOD4 | O14618

Gen-ID: 9973

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis