AKAP2 Antikörper (C-Term)

Produktnummer ABIN5518729

Produktdetails anti-AKAP2 Antikörper

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Bindungsspezifität: AA 813-852, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.

Sequenz: ETHKSKRRER MDDSSVLEAT RVNRRKSALA LRWEAGIYAN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for A-kinase anchor protein 2(AKAP2) detection. Tested with WB in Human,Rat.
Gene Name: A-kinase anchoring protein 2
Protein Name: A-kinase anchor protein 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu AKAP2

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Andere Bezeichnung: AKAP2 (AKAP2 Produkte)

Synonyme: AKAP-2 antikoerper, AKAPKL antikoerper, PRKA2 antikoerper, AA959716 antikoerper, AI649048 antikoerper, Akap-2 antikoerper, Akap-kl antikoerper, B230340M18Rik antikoerper, Prka2 antikoerper, akap-kl antikoerper, AKAP2 antikoerper, PALM2 antikoerper, A-kinase anchoring protein 2 antikoerper, A kinase (PRKA) anchor protein 2 antikoerper, A-kinase anchoring protein 2 L homeolog antikoerper, A-kinase anchor protein 2 antikoerper, AKAP2 antikoerper, Akap2 antikoerper, akap2.L antikoerper, akap2 antikoerper, LOC101114239 antikoerper

Hintergrund: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

Synonyms: AKAP 2 | AKAP KL | AKAPKL | KIAA0920 | PRKA 2 | PRKA2 | MISP2 | Q9Y2D5

Gen-ID: 11217

UniProt: Q9Y2D5