Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

CD93 Antikörper (CD93 Molecule) (AA 33-140) Primary Antibody

CD93 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 1A4 unconjugated
Produktnummer ABIN524853
$600.00
Zzgl. Versandkosten $45.00
100 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    CD93
    Bindungsspezifität
    AA 33-140
    • 15
    • 7
    • 4
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 44
    • 24
    • 23
    Wirt
    Maus
    • 32
    • 19
    • 4
    Klonalität
    Monoklonal
    • 30
    • 25
    Konjugat
    Dieser CD93 Antikörper ist unkonjugiert
    • 29
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    ELISA, Western Blotting (WB)
    • 23
    • 20
    • 15
    • 14
    • 13
    • 9
    • 8
    • 3
    • 3
    • 1
    • 1
    • 1
    Verwendungszweck
    Mouse monoclonal antibody raised against a partial recombinant CD93.
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR

    Klon
    1A4
    Isotyp
    IgG3 lambda
  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CD93
    Andere Bezeichnung
    CD93 (CD93 Antibody Abstract)
    Synonyme
    6030404G09Rik, AA145088, AA4.1, AW555904, C1qr1, C1qrp, Ly68, C1QR1, C1qR(P), C1qRP, CDw93, ECSM3, MXRA4, dJ737E23.1, C1qRp, CD93 antigen, CD93 molecule, Cd93, CD93
    Hintergrund
    Full Gene Name: CD93 Molecule
    Synonyms: C1QR1,C1qR(P),C1qRP,CDw93,MXRA4,dJ737E23.1
    Gen-ID
    22918
    NCBI Accession
    NP_036204, NM_012072
Sie sind hier:
help Kundenservice