SP5 Antikörper

Produktnummer ABIN4952680

Produktdetails anti-SP5 Antikörper

Target: SP5 (Sp5 Transcription Factor (SP5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Sp5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Sp5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SP5

Target: SP5 (Sp5 Transcription Factor (SP5))

Andere Bezeichnung: Sp5 (SP5 Produkte)

Synonyme: bts1 antikoerper, fc39b01 antikoerper, wu:fc39b01 antikoerper, Bricd6 antikoerper, SP-C antikoerper, SP5 antikoerper, SPC antikoerper, Sftp-2 antikoerper, Sftp2 antikoerper, pro-SpC antikoerper, Sp5 transcription factor antikoerper, Sp5 transcription factor a antikoerper, surfactant associated protein C antikoerper, trans-acting transcription factor 5 antikoerper, Sp5 antikoerper, sp5a antikoerper, SP5 antikoerper, CpipJ_CPIJ003609 antikoerper, Sftpc antikoerper

Hintergrund: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

UniProt: Q6BEB4